Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP20 Rabbit Polyclonal Antibody (HRP)

CFAP20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GTL3, BUG22, EVORF, fSAP23, C16orf80

UniProt

Q9Y6A4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GTL3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037374

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Septin 2 (SEPT2) (NM_001008491) Human Tagged Lenti ORF Clone
RC224864L3 10 µg

Septin 2 (SEPT2) (NM_001008491) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PMP22 CytoSection
TS404349P5 25 Slides

PMP22 CytoSection

Sign In for Pricing
View Details
Rat Olfactory receptor 2L8 (OR2L8) ELISA Kit
GTR10355018 96 Well

Rat Olfactory receptor 2L8 (OR2L8) ELISA Kit

Sign In for Pricing
View Details
Human Tenascin-C/TNC Antibody , PerCP
E55A09415 50 Tests

Human Tenascin-C/TNC Antibody , PerCP

Sign In for Pricing
View Details
Native Aspergillus niger Pectinase
NATE-0535 250 g

Native Aspergillus niger Pectinase

Sign In for Pricing
View Details
CARTPT antibody
70R-16173 50 μL

CARTPT antibody

Sign In for Pricing
View Details