Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cnot3 Rabbit Polyclonal Antibody (FITC)

Cnot3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

D3ZUV9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of RAT Cnot3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CTTENSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-770-5p miRNA Antagomir
orb1915849-01 10 nmol

Hsa-miR-770-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-770-5p miRNA Antagomir
orb1915849-02 20 nmol

Hsa-miR-770-5p miRNA Antagomir

Sign In for Pricing
View Details
Anti-Aldolase/ALDOA Antibody Picoband® (monoclonal, 6H8), Dylight550 Conjugate
M05022-2-Dylight550 100 µg

Anti-Aldolase/ALDOA Antibody Picoband® (monoclonal, 6H8), Dylight550 Conjugate

Sign In for Pricing
View Details
Lentiviral mouse Sp5 shRNA (UAS) - Lentiviral mouse Sp5 shRNA (UAS, iRFP) plasmid
GTR15185152 1 Vial

Lentiviral mouse Sp5 shRNA (UAS) - Lentiviral mouse Sp5 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Hsa-miR-4523 miRNA Inhibitor
orb1872156-01 10 nmol

Hsa-miR-4523 miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-4523 miRNA Inhibitor
orb1872156-02 20 nmol

Hsa-miR-4523 miRNA Inhibitor

Sign In for Pricing
View Details