Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDR2L Rabbit Polyclonal Antibody (Biotin)

CDR2L Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HUMPPA

UniProt

Q86X02

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CDR2L

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_055418

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Terminal-Binding Protein 1 (CTBP1) Antibody
abx126875-01 100 µL

C-Terminal-Binding Protein 1 (CTBP1) Antibody

Sign In for Pricing
View Details
C-Terminal-Binding Protein 1 (CTBP1) Antibody
abx126875-02 200 µL

C-Terminal-Binding Protein 1 (CTBP1) Antibody

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Antibody (CB6)
12-9071-50 50 µg

Anti-SARS-CoV-2 Antibody (CB6)

Sign In for Pricing
View Details
IKK alpha, phosphorylated (Ser176, Ser180) (IKKa, IKK1, IkappaB Kinase alpha, Conserved Helix Loop Helix Ubiquitous Kinase, CHUK1, IkappaB Kinase 1, IkB Kinase alpha, IKBKa, IKK1, Inhibitor Of kappa Light Polypeptide Gene Enhancer In B Cells, Inhibitor Of Nuclear Factor kappa B Kinase alpha, NFKBIKa, TCF16) (Biotin) discontinued
I3000-07M-Biotin 100 µL

IKK alpha, phosphorylated (Ser176, Ser180) (IKKa, IKK1, IkappaB Kinase alpha, Conserved Helix Loop Helix Ubiquitous Kinase, CHUK1, IkappaB Kinase 1, IkB Kinase alpha, IKBKa, IKK1, Inhibitor Of kappa Light Polypeptide Gene Enhancer In B Cells, Inhibitor Of Nuclear Factor kappa B Kinase alpha, NFKBIKa, TCF16) (Biotin) discontinued

Sign In for Pricing
View Details
CUL5 Knockout SK-HEP-1 Polyclonal Cells
ARG15393 1 Million

CUL5 Knockout SK-HEP-1 Polyclonal Cells

Sign In for Pricing
View Details
OPLAH sgRNA CRISPR Lentivector (Human) (Target 2)
K1484303 1.0 µg DNA

OPLAH sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details