Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SART3 Rabbit Polyclonal Antibody (FITC)

SART3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P100, p110, DSAP1, TIP110, p110 (nrb), RP11-13G14

UniProt

Q15020

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SART3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAIS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055521

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX5B Rabbit Polyclonal Antibody
orb555957 100 µL

COX5B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Sema3e shRNA (UAS) - Lentiviral mouse Sema3e shRNA (UAS) (100)
GTR15256062 1 Vial

Lentiviral mouse Sema3e shRNA (UAS) - Lentiviral mouse Sema3e shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Brucella suis biovar 1 Phosphoribosyl-AMP cyclohydrolase (hisI)
MBS1470329-01 0.02 mg (E-Coli)

Recombinant Brucella suis biovar 1 Phosphoribosyl-AMP cyclohydrolase (hisI)

Sign In for Pricing
View Details
Recombinant Brucella suis biovar 1 Phosphoribosyl-AMP cyclohydrolase (hisI)
MBS1470329-02 0.1 mg (E-Coli)

Recombinant Brucella suis biovar 1 Phosphoribosyl-AMP cyclohydrolase (hisI)

Sign In for Pricing
View Details
Recombinant Brucella suis biovar 1 Phosphoribosyl-AMP cyclohydrolase (hisI)
MBS1470329-03 0.02 mg (Yeast)

Recombinant Brucella suis biovar 1 Phosphoribosyl-AMP cyclohydrolase (hisI)

Sign In for Pricing
View Details
Recombinant Brucella suis biovar 1 Phosphoribosyl-AMP cyclohydrolase (hisI)
MBS1470329-04 0.1 mg (Yeast)

Recombinant Brucella suis biovar 1 Phosphoribosyl-AMP cyclohydrolase (hisI)

Sign In for Pricing
View Details