Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SART3 Rabbit Polyclonal Antibody (HRP)

SART3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P100, p110, DSAP1, TIP110, p110 (nrb), RP11-13G14

UniProt

Q15020

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SART3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAIS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055521

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMC2 Antibody
A54975-100UG 100 µg

LAMC2 Antibody

Sign In for Pricing
View Details
TMIGD1 Human Over-expression Lysate
orb1355493 100 µg

TMIGD1 Human Over-expression Lysate

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glucosidase Alpha, Acid (GaA)
MBS2039176-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Glucosidase Alpha, Acid (GaA)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glucosidase Alpha, Acid (GaA)
MBS2039176-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Glucosidase Alpha, Acid (GaA)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glucosidase Alpha, Acid (GaA)
MBS2039176-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Glucosidase Alpha, Acid (GaA)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glucosidase Alpha, Acid (GaA)
MBS2039176-04 1 mL

Cy3-Linked Polyclonal Antibody to Glucosidase Alpha, Acid (GaA)

Sign In for Pricing
View Details