Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SART3 Rabbit Polyclonal Antibody (Biotin)

SART3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P100, p110, DSAP1, TIP110, p110 (nrb), RP11-13G14

UniProt

Q15020

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SART3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAIS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055521

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Small leucine rich protein 1 (SmLR1) (NM_001195597) Human Over-expression Lysate
LC433943 20 µg

Small leucine rich protein 1 (SmLR1) (NM_001195597) Human Over-expression Lysate

Sign In for Pricing
View Details
Acsm5 Rabbit Polyclonal Antibody
TA363383 100 µL

Acsm5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF405S conjugate, 0.1mg/mL
BNC042685-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LEF1 (NM_001130713) Human Over-expression Lysate
LY427260 100 µg

LEF1 (NM_001130713) Human Over-expression Lysate

Sign In for Pricing
View Details
TMPRSS5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G4]
TA504339BM 100 µL

TMPRSS5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G4]

Sign In for Pricing
View Details
Cezanne (OTUD7B) (NM_020205) Human Recombinant Protein
TP309932 20 µg

Cezanne (OTUD7B) (NM_020205) Human Recombinant Protein

Sign In for Pricing
View Details