Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SART3 Rabbit Polyclonal Antibody (Biotin)

SART3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P100, p110, DSAP1, TIP110, p110 (nrb), RP11-13G14

UniProt

Q15020

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SART3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAIS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055521

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105M1-01 50 Tests

Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105M1-02 100 Tests

Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
PPIL4 Human qPCR Primer Pair (NM_139126)
HP217119 200 Reactions

PPIL4 Human qPCR Primer Pair (NM_139126)

Sign In for Pricing
View Details
Amisulpride N-Oxide
TRC-A633265-25MG 25 mg

Amisulpride N-Oxide

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF640R conjugate, 0.1mg/mL
BNC401125-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details