Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MANSC1 Rabbit Polyclonal Antibody (HRP)

MANSC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LOH12CR3, 9130403P13Rik

UniProt

Q9H8J5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MANSC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTLRLSASQNCLKKSLEDVVIDIQSSLSKGIRGNEPVYTSTQEDCINSCC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_060520

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-18 (Interleukin-18) BioAssayTM ELISA Kit (Bovine) discontinued
370023-01 48 Tests

IL-18 (Interleukin-18) BioAssayTM ELISA Kit (Bovine) discontinued

Sign In for Pricing
View Details
IL-18 (Interleukin-18) BioAssayTM ELISA Kit (Bovine) discontinued
370023-02 96 Tests

IL-18 (Interleukin-18) BioAssayTM ELISA Kit (Bovine) discontinued

Sign In for Pricing
View Details
CD10, CT (Atriopeptidase, CALLA, CD 10, Common Acute Lymphocytic Leukemia Antigen, Enkephalinase, EPN, gp100, Membrane Metalloendopeptidase, MME, Neprilysin, NEP, Neutral Endopeptidase 24.11, Pmel17) (AP) discontinued
C2261-40T-AP 200 µL

CD10, CT (Atriopeptidase, CALLA, CD 10, Common Acute Lymphocytic Leukemia Antigen, Enkephalinase, EPN, gp100, Membrane Metalloendopeptidase, MME, Neprilysin, NEP, Neutral Endopeptidase 24.11, Pmel17) (AP) discontinued

Sign In for Pricing
View Details
Anti-SPR Polyclonal Antibody
TMAB-13133-01 50 μL

Anti-SPR Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SPR Polyclonal Antibody
TMAB-13133-02 100 µL

Anti-SPR Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SPR Polyclonal Antibody
TMAB-13133-03 200 µL

Anti-SPR Polyclonal Antibody

Sign In for Pricing
View Details