Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGC4618 Rabbit Polyclonal Antibody (FITC)

MGC4618 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HTMEM175

UniProt

Q9BSA9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MGC4618

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLM

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_115702

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF740 conjugate, 0.1mg/mL
BNC740923-500 1x 500 µL

Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX2 (Embryonic Stem Cell Marker) (SOX2/3811R), CF405S conjugate, 0.1mg/mL
BNC043811-500 1x 500 µL

SOX2 (Embryonic Stem Cell Marker) (SOX2/3811R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS631399 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Human TRAPPC2L activation kit by CRISPRa
GA109945 1 Kit

Human TRAPPC2L activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Pnrc2 activation kit by CRISPRa
GA205522 1 Kit

Mouse Pnrc2 activation kit by CRISPRa

Sign In for Pricing
View Details
Rat Complement 1 Inhibitor (C1INH) ELISA Kit
RDR-C1INH-Ra-01 96 Tests

Rat Complement 1 Inhibitor (C1INH) ELISA Kit

Sign In for Pricing
View Details