Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Csrp2 Rabbit Polyclonal Antibody (FITC)

Csrp2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cr, Sm, Crp2, SmLim, AW551867

UniProt

P97314

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPW

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031818

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEIL2 (Endonuclease 8-like 2, DNA Glycosylase/AP Lyase Neil2, DNA-(apurinic or apyrimidinic site) Lyase Neil2, Endonuclease VIII-like 2, Nei Homolog 2, Nei-like Protein 2, FLJ31644, MGC2832, MGC4505, NEH2, NEI2) (MaxLight 650)
MBS6223422-01 0.1 mL

NEIL2 (Endonuclease 8-like 2, DNA Glycosylase/AP Lyase Neil2, DNA-(apurinic or apyrimidinic site) Lyase Neil2, Endonuclease VIII-like 2, Nei Homolog 2, Nei-like Protein 2, FLJ31644, MGC2832, MGC4505, NEH2, NEI2) (MaxLight 650)

Sign In for Pricing
View Details
NEIL2 (Endonuclease 8-like 2, DNA Glycosylase/AP Lyase Neil2, DNA-(apurinic or apyrimidinic site) Lyase Neil2, Endonuclease VIII-like 2, Nei Homolog 2, Nei-like Protein 2, FLJ31644, MGC2832, MGC4505, NEH2, NEI2) (MaxLight 650)
MBS6223422-02 5x 0.1 mL

NEIL2 (Endonuclease 8-like 2, DNA Glycosylase/AP Lyase Neil2, DNA-(apurinic or apyrimidinic site) Lyase Neil2, Endonuclease VIII-like 2, Nei Homolog 2, Nei-like Protein 2, FLJ31644, MGC2832, MGC4505, NEH2, NEI2) (MaxLight 650)

Sign In for Pricing
View Details
TRNAI11 Protein Vector (Human) (pPB-C-His)
PV139002 500 ng

TRNAI11 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human herpesvirus 2 Envelope glycoprotein H (gH), partial
CSB-EP308575HJX-01 20 µg

Recombinant Human herpesvirus 2 Envelope glycoprotein H (gH), partial

Sign In for Pricing
View Details
Recombinant Human herpesvirus 2 Envelope glycoprotein H (gH), partial
CSB-EP308575HJX-02 100 µg

Recombinant Human herpesvirus 2 Envelope glycoprotein H (gH), partial

Sign In for Pricing
View Details
Recombinant Human herpesvirus 2 Envelope glycoprotein H (gH), partial
CSB-EP308575HJX-03 1 mg

Recombinant Human herpesvirus 2 Envelope glycoprotein H (gH), partial

Sign In for Pricing
View Details