Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELK4 Rabbit Polyclonal Antibody (Biotin)

ELK4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SAP1

UniProt

P28324

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ELK4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPSTPGPFSPDLQKT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001964

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nurr1 Rabbit Polyclonal Antibody (PE-Cy7)
orb969235 100 µL

Nurr1 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
WDR58 (THO Complex Subunit 6 Homolog, WD Repeat-containing Protein 58, Functional Spliceosome-associated Protein 35, fSAP35, THOC6, PSEC0006) (Azide Free) (MaxLight 490)
MBS6199150-01 0.1 mL

WDR58 (THO Complex Subunit 6 Homolog, WD Repeat-containing Protein 58, Functional Spliceosome-associated Protein 35, fSAP35, THOC6, PSEC0006) (Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
WDR58 (THO Complex Subunit 6 Homolog, WD Repeat-containing Protein 58, Functional Spliceosome-associated Protein 35, fSAP35, THOC6, PSEC0006) (Azide Free) (MaxLight 490)
MBS6199150-02 5x 0.1 mL

WDR58 (THO Complex Subunit 6 Homolog, WD Repeat-containing Protein 58, Functional Spliceosome-associated Protein 35, fSAP35, THOC6, PSEC0006) (Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
Anti-SCRIBBLE Antibody Picoband® (iFluor647 Conjugate)
A01651-iFluor647 100 µg

Anti-SCRIBBLE Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
Programmed Cell Death Protein 1 (PD1) Antibody
abx170998-01 100 µL

Programmed Cell Death Protein 1 (PD1) Antibody

Sign In for Pricing
View Details
Programmed Cell Death Protein 1 (PD1) Antibody
abx170998-02 200 µL

Programmed Cell Death Protein 1 (PD1) Antibody

Sign In for Pricing
View Details