Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELK4 Rabbit Polyclonal Antibody (Biotin)

ELK4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SAP1

UniProt

P28324

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ELK4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPSTPGPFSPDLQKT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001964

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SurE Antibody
orb832692 2 mg

SurE Antibody

Sign In for Pricing
View Details
Equine Myeloperoxidase (MPO) ELISA Kit-Sandwich
EK12F886-01 48 Test

Equine Myeloperoxidase (MPO) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Equine Myeloperoxidase (MPO) ELISA Kit-Sandwich
EK12F886-02 96 Tests

Equine Myeloperoxidase (MPO) ELISA Kit-Sandwich

Sign In for Pricing
View Details
CDK6, phosphorylated (Tyr13) (Cell Division Protein Kinase 6, Serine/Threonine-protein Kinase PLSTIRE, Crk2, MGC59692) discontinued
C2576-01F 50 µg

CDK6, phosphorylated (Tyr13) (Cell Division Protein Kinase 6, Serine/Threonine-protein Kinase PLSTIRE, Crk2, MGC59692) discontinued

Sign In for Pricing
View Details
Human Acetylcholinesterase (AchE) Antibody Pair Kit (with Standard)
MBS2100395-01 5x 96 Tests

Human Acetylcholinesterase (AchE) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Acetylcholinesterase (AchE) Antibody Pair Kit (with Standard)
MBS2100395-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Acetylcholinesterase (AchE) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details