Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP36 Rabbit Polyclonal Antibody (HRP)

ZFP36 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TTP, G0S24, GOS24, TIS11, NUP475, zfp-36, RNF162A

UniProt

P26651

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_003398

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dystrobrevin alpha (DTNA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A2]
TA502207AM 100 µL

Dystrobrevin alpha (DTNA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A2]

Sign In for Pricing
View Details
Asoxime Dimesylate
TRC-A820485-100MG 100 mg

Asoxime Dimesylate

Sign In for Pricing
View Details
ZAP70 Mouse Monoclonal Antibody [Clone ID: ZAP-03]
AM03112PU-N 100 µg

ZAP70 Mouse Monoclonal Antibody [Clone ID: ZAP-03]

Sign In for Pricing
View Details
ADAMTS8 (NM_007037) Human Recombinant Protein
TP312446SE 20 µg

ADAMTS8 (NM_007037) Human Recombinant Protein

Sign In for Pricing
View Details
Human FGF22 activation kit by CRISPRa
GA108963 1 Kit

Human FGF22 activation kit by CRISPRa

Sign In for Pricing
View Details
(Z-DEVD) 2-R110
13430-AAT 1 mg

(Z-DEVD) 2-R110

Sign In for Pricing
View Details