Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZYX Rabbit Polyclonal Antibody (HRP)

ZYX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ESP-2, HED-2

UniProt

Q15942

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZYX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003452

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX6-3 antibody - middle region
MBS3204910-01 0.1 mL

NKX6-3 antibody - middle region

Sign In for Pricing
View Details
NKX6-3 antibody - middle region
MBS3204910-02 5x 0.1 mL

NKX6-3 antibody - middle region

Sign In for Pricing
View Details
OVA Conjugated Human Serum Amyloid A (SAA)
RPU50828-01 50 µg

OVA Conjugated Human Serum Amyloid A (SAA)

Sign In for Pricing
View Details
OVA Conjugated Human Serum Amyloid A (SAA)
RPU50828-02 100 µg

OVA Conjugated Human Serum Amyloid A (SAA)

Sign In for Pricing
View Details
OVA Conjugated Human Serum Amyloid A (SAA)
RPU50828-03 1 mg

OVA Conjugated Human Serum Amyloid A (SAA)

Sign In for Pricing
View Details
Goat Calcitonin Receptor ELISA Kit
MBS009405 Inquire

Goat Calcitonin Receptor ELISA Kit

Sign In for Pricing
View Details