Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSRP1 Rabbit Polyclonal Antibody (HRP)

CSRP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CRP, CRP1, CSRP, CYRP, D1S181E, HEL-141, HEL-S-286

UniProt

P21291

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CSRP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004069

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM106B Protein Vector (Rat) (pPB-C-His)
PV311242 500 ng

TMEM106B Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Lauryl Sulfate Broth (Powder)
MBS652895-01 500 g

Lauryl Sulfate Broth (Powder)

Sign In for Pricing
View Details
Lauryl Sulfate Broth (Powder)
MBS652895-02 5x 500 g

Lauryl Sulfate Broth (Powder)

Sign In for Pricing
View Details
Slt Antibody
orb832171 2 mg

Slt Antibody

Sign In for Pricing
View Details
Hspb6 3'UTR Luciferase Stable Cell Line
TU109808 1.0 mL

Hspb6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Maf1 shRNA (UAS) - Lentiviral mouse Maf1 shRNA (UAS) plasmid
GTR15230995 1 Vial

Lentiviral mouse Maf1 shRNA (UAS) - Lentiviral mouse Maf1 shRNA (UAS) plasmid

Sign In for Pricing
View Details