Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB7 Rabbit Polyclonal Antibody (Biotin)

HOXB7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HOX2, HOX2C, HHO.C1, Hox-2.3

UniProt

P09629

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HOXB7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

IF, WB

NCBI Accession Number

NP_004493

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synapsin II Antibody
GWB-25F5D0 0.05 mL

Synapsin II Antibody

Sign In for Pricing
View Details
Chicken thyroxine (T4) Elisa Kit
EK780084 96 Well

Chicken thyroxine (T4) Elisa Kit

Sign In for Pricing
View Details
Mouse Signal Transducer and Activator of Transcription 4 (STAT4) ELISA Kit
abx254436-01 96 Tests

Mouse Signal Transducer and Activator of Transcription 4 (STAT4) ELISA Kit

Sign In for Pricing
View Details
Mouse Signal Transducer and Activator of Transcription 4 (STAT4) ELISA Kit
abx254436-02 5x 96 Tests

Mouse Signal Transducer and Activator of Transcription 4 (STAT4) ELISA Kit

Sign In for Pricing
View Details
Mouse Signal Transducer and Activator of Transcription 4 (STAT4) ELISA Kit
abx254436-03 10x 96 Tests

Mouse Signal Transducer and Activator of Transcription 4 (STAT4) ELISA Kit

Sign In for Pricing
View Details
OPLAH ELISA Kit (Bovine) (OKEH08634)
OKEH08634 96 Well

OPLAH ELISA Kit (Bovine) (OKEH08634)

Sign In for Pricing
View Details