Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX1 Rabbit Polyclonal Antibody (Biotin)

CBX1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CBX, M31, MOD1, p25beta, HP1-BETA, HP1Hsbeta, HP1Hs-beta

UniProt

P83916

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CBX1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006798

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ints3 shRNA (UAS) - Lentiviral mouse Ints3 shRNA (UAS) (100)
GTR15176010 1 Vial

Lentiviral mouse Ints3 shRNA (UAS) - Lentiviral mouse Ints3 shRNA (UAS) (100)

Sign In for Pricing
View Details
BCA (Bicinchoninic Acid) Protein Assay Kit With Ovalbumin Standard
20831011-1 500 Assays

BCA (Bicinchoninic Acid) Protein Assay Kit With Ovalbumin Standard

Sign In for Pricing
View Details
Mouse Anti-Human IL-12 monoclonal antibody, clone C-Q51
CABT-ZB356 200 µg

Mouse Anti-Human IL-12 monoclonal antibody, clone C-Q51

Sign In for Pricing
View Details
Mouse Tolloid-Like Protein 1 (TLL1) ELISA Kit
MBS9716824-01 48 Tests

Mouse Tolloid-Like Protein 1 (TLL1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tolloid-Like Protein 1 (TLL1) ELISA Kit
MBS9716824-02 96 Tests

Mouse Tolloid-Like Protein 1 (TLL1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tolloid-Like Protein 1 (TLL1) ELISA Kit
MBS9716824-03 5x 96 Tests

Mouse Tolloid-Like Protein 1 (TLL1) ELISA Kit

Sign In for Pricing
View Details