Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C11orf9 Rabbit Polyclonal Antibody (HRP)

C11orf9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRF, CUGS, MMERV, Ndt80, 11orf9, pqn-47, C11orf9

UniProt

Q9Y2G1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C11orf9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GTGPPIKAEPKAPYAPGTLPDSPPDSGSEAYSPQQVNEPHLLRTITPETL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

120kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037411

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF1 Mouse Monoclonal Antibody [Clone ID: OTI4B12]
CF805748 100 µg

IGF1 Mouse Monoclonal Antibody [Clone ID: OTI4B12]

Sign In for Pricing
View Details
Human Parathyroid Hormone Receptor 2 (PTHR2) ELISA Kit
RD-PTHR2-Hu-01 96 Tests

Human Parathyroid Hormone Receptor 2 (PTHR2) ELISA Kit

Sign In for Pricing
View Details
Human Parathyroid Hormone Receptor 2 (PTHR2) ELISA Kit
RD-PTHR2-Hu-02 48 Tests

Human Parathyroid Hormone Receptor 2 (PTHR2) ELISA Kit

Sign In for Pricing
View Details
PIGT (NM_001184729) Human Over-expression Lysate
LC433206 20 µg

PIGT (NM_001184729) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IPO11 activation kit by CRISPRa
GA109640 1 Kit

Human IPO11 activation kit by CRISPRa

Sign In for Pricing
View Details
Normeperidine Hydrochloride
TRC-N718500-1G 1 g

Normeperidine Hydrochloride

Sign In for Pricing
View Details