Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD2 Rabbit Polyclonal Antibody (HRP)

BTBD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9BX70

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BTBD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AFLFNNEVLCDVHFLVGKGLSSQRIPAHRFVLAVGSAVFDAMFNGGMATT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060267

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM8 (C20orf154, DNA Helicase MCM8, Minichromosome Maintenance 8, MGC119522, MGC119523, MGC12866, MGC4816, REC, DJ967N21.5) (MaxLight 550)
129504-ML550 100 µL

MCM8 (C20orf154, DNA Helicase MCM8, Minichromosome Maintenance 8, MGC119522, MGC119523, MGC12866, MGC4816, REC, DJ967N21.5) (MaxLight 550)

Sign In for Pricing
View Details
IGF2BP3 Antibody Blocking Peptide
orb1510857 500 µg

IGF2BP3 Antibody Blocking Peptide

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB622842 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
alpha 5 Defensin (DEFA5) (NM_021010) Human Recombinant Protein
TP310219 20 µg

alpha 5 Defensin (DEFA5) (NM_021010) Human Recombinant Protein

Sign In for Pricing
View Details
CMPK1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A2]
TA505366AM 100 µL

CMPK1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A2]

Sign In for Pricing
View Details
ADGRE5 Antibody
OACA09067-100UL 100 µL

ADGRE5 Antibody

Sign In for Pricing
View Details