Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM68 Rabbit Polyclonal Antibody (Biotin)

TRIM68 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SS56, GC109, SS-56, RNF137

UniProt

Q96PF7

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM68

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RLRKGNEYRAGTDEYPILSLPVPPRRVGIFVDYEAHDISFYNVTDCGSHI

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_060543

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PC Bottle, Flat Bottom, TPE Tube (50 cm, 1/8" ID, 1/4" OD), Heat seal, Vent Filter (0.22 μm, 13.8 cm²), Sterile, Double Bag Package, 1 pc/pack, 4 packs/case, 4 pcs/case
C31021-AZC050A 4 PCS/CS

PC Bottle, Flat Bottom, TPE Tube (50 cm, 1/8" ID, 1/4" OD), Heat seal, Vent Filter (0.22 μm, 13.8 cm²), Sterile, Double Bag Package, 1 pc/pack, 4 packs/case, 4 pcs/case

Sign In for Pricing
View Details
NIPSNAP3A AAV siRNA Pooled Vector
31853161 1.0 µg

NIPSNAP3A AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lentiviral human CHIC2 shRNA (UAS) - Lentiviral human CHIC2 shRNA (UAS, GFP) plasmid
GTR15153862 1 Vial

Lentiviral human CHIC2 shRNA (UAS) - Lentiviral human CHIC2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Zmym6-set siRNA/shRNA/RNAi Lentivector (Mouse)
51281094 4x 500 ng

Zmym6-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
BMP9 (GDF2) Antibody (N-term)
MBS9208359-01 0.08 mL

BMP9 (GDF2) Antibody (N-term)

Sign In for Pricing
View Details
BMP9 (GDF2) Antibody (N-term)
MBS9208359-02 0.4 mL

BMP9 (GDF2) Antibody (N-term)

Sign In for Pricing
View Details