Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRN3 Rabbit Polyclonal Antibody (FITC)

RRN3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TIFIA, A-270G1.2

UniProt

Q9NYV6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RRN3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSVGSPPVLYM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_060897

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lung cancer tissue array, including TNM and pathology grade, 24 cases/72 cores
LC721 1 Each

Lung cancer tissue array, including TNM and pathology grade, 24 cases/72 cores

Sign In for Pricing
View Details
DGKQ, NT (Diacylglycerol Kinase theta, DAG Kinase theta, Diglyceride Kinase theta, DGK-theta, DAGK4) (MaxLight 750) discontinued
D3441-88A-ML750 100 µL

DGKQ, NT (Diacylglycerol Kinase theta, DAG Kinase theta, Diglyceride Kinase theta, DGK-theta, DAGK4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Slc25a30 shRNA (UAS) - Lentiviral mouse Slc25a30 shRNA (UAS) plasmid
GTR15266551 1 Vial

Lentiviral mouse Slc25a30 shRNA (UAS) - Lentiviral mouse Slc25a30 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal TTC33 Antibody [mFluor Violet 610 SE]
NBP2-97329MFV610 0.1 mL

Rabbit Polyclonal TTC33 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Fatty acid-binding protein, liver
AP83046 1 mg

Fatty acid-binding protein, liver

Sign In for Pricing
View Details
HPCL2 Polyclonal Antibody, Cy7 Conjugated
bs-4046R-Cy7 100 µL

HPCL2 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details