Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRN3 Rabbit Polyclonal Antibody (FITC)

RRN3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TIFIA, A-270G1.2

UniProt

Q9NYV6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RRN3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSVGSPPVLYM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_060897

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Wnt2b Antibody Picoband® (Dylight488 Conjugate)
PB9462-Dylight488 100 µg

Anti-Wnt2b Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Mouse Monoclonal ORF73/HHV8 Antibody (4C11) [Alexa Fluor 532]
NBP1-30176AF532 0.1 mL

Mouse Monoclonal ORF73/HHV8 Antibody (4C11) [Alexa Fluor 532]

Sign In for Pricing
View Details
Cox18 (NM_001163456) Mouse Tagged Lenti ORF Clone
MR217163L4 10 µg

Cox18 (NM_001163456) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Monoclonal Poly-Ubiquitin Antibody (Genentech patent anti-Polyubiquitin) [HRP]
NBP3-27986H 0.1 mL

Human Monoclonal Poly-Ubiquitin Antibody (Genentech patent anti-Polyubiquitin) [HRP]

Sign In for Pricing
View Details
TMEM50B CRISPR/Cas9 KO Plasmid (m)
sc-429606 20 µg

TMEM50B CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
F11 (Coagulation Factor XI, FXI, Plasma Thromboplastin Antecedent, PTA, MGC141891) (APC)
126533-APC 100 µL

F11 (Coagulation Factor XI, FXI, Plasma Thromboplastin Antecedent, PTA, MGC141891) (APC)

Sign In for Pricing
View Details