Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRN3 Rabbit Polyclonal Antibody (HRP)

RRN3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TIFIA, A-270G1.2

UniProt

Q9NYV6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RRN3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSVGSPPVLYM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_060897

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKN-7 [MKN7; MKN 7] Cell Line
CL-0574 1x 10^6 Cells/Vial - 2 Vials

MKN-7 [MKN7; MKN 7] Cell Line

Sign In for Pricing
View Details
RGS3 Antibody
31-064 100 µL

RGS3 Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human PFDN6 pAb
PA5170-01 50 μL

Rabbit Anti-Human PFDN6 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human PFDN6 pAb
PA5170-02 100 μL

Rabbit Anti-Human PFDN6 pAb

Sign In for Pricing
View Details
F-box/LRR-repeat protein 14 Antibody (Fluoro594)
orb3166061 100 µg

F-box/LRR-repeat protein 14 Antibody (Fluoro594)

Sign In for Pricing
View Details
RAB8A Rabbit pAb, IRDye 800CW conjugated
orb2825291 100 µL

RAB8A Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details