Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIER1 Rabbit Polyclonal Antibody (HRP)

MIER1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ER1, MI-ER1

UniProt

Q8NES5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MIER1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRTGDEKGVEAIPEGSHIKDNEQALYELVKCNFDTEEALRRLRF

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065999

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PPP4R1 Antibody Picoband® (Dylight488 Conjugate)
A14144-2-Dylight488 100 µg

Anti-PPP4R1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
MED18, CT (MED18, Mediator of RNA polymerase II transcription subunit 18, Mediator complex subunit 18, p28b) (MaxLight 550) discontinued
038319-ML550 100 µL

MED18, CT (MED18, Mediator of RNA polymerase II transcription subunit 18, Mediator complex subunit 18, p28b) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Recombinant Human GSTP1 protein, No Tag
MBS1560815-01 0.05 mg

Recombinant Human GSTP1 protein, No Tag

Sign In for Pricing
View Details
Recombinant Human GSTP1 protein, No Tag
MBS1560815-02 0.1 mg

Recombinant Human GSTP1 protein, No Tag

Sign In for Pricing
View Details
Recombinant Human GSTP1 protein, No Tag
MBS1560815-03 5x 0.1 mg

Recombinant Human GSTP1 protein, No Tag

Sign In for Pricing
View Details
Human BLMH qPCR Primer Pair
QH11017S 200 Tests

Human BLMH qPCR Primer Pair

Sign In for Pricing
View Details