Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIER1 Rabbit Polyclonal Antibody (Biotin)

MIER1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ER1, MI-ER1

UniProt

Q8NES5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MIER1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RRTGDEKGVEAIPEGSHIKDNEQALYELVKCNFDTEEALRRLRF

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065999

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pseudomonas aeruginosa PILM Rabbit Polyclonal Antibody (PE)
orb2573144 200 µL

Pseudomonas aeruginosa PILM Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
SLC26A8 (Testis Anion Transporter 1, Anion Exchange Transporter, Solute Carrier Family 26 Member 8, TAT1, FLJ32714) (HRP)
138364-HRP 100 µL

SLC26A8 (Testis Anion Transporter 1, Anion Exchange Transporter, Solute Carrier Family 26 Member 8, TAT1, FLJ32714) (HRP)

Sign In for Pricing
View Details
PTPRJ Protein Vector (Rat) (pPB-N-His)
PV297327 500 ng

PTPRJ Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 153 protein (mug153)
MBS1418658-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 153 protein (mug153)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 153 protein (mug153)
MBS1418658-02 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 153 protein (mug153)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 153 protein (mug153)
MBS1418658-03 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 153 protein (mug153)

Sign In for Pricing
View Details