Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIN28 Rabbit Polyclonal Antibody (FITC)

LIN28 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CSDD1, LIN28, LIN-28, ZCCHC1, lin-28A

UniProt

Q9H9Z2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LIN28

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast

Tested Applications

IHC, WB

NCBI Accession Number

NP_078950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ACIN1 shRNA (UAS) - Lentiviral human ACIN1 shRNA (UAS, RFP) plasmid
GTR15099649 1 Vial

Lentiviral human ACIN1 shRNA (UAS) - Lentiviral human ACIN1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
DRD1 Rabbit Polyclonal Antibody
orb585711 100 µL

DRD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Monkey Phospho-Nuclear Factor kappa B ELISA Kit
MBS743649-01 48 Well

Monkey Phospho-Nuclear Factor kappa B ELISA Kit

Sign In for Pricing
View Details
Monkey Phospho-Nuclear Factor kappa B ELISA Kit
MBS743649-02 96 Well

Monkey Phospho-Nuclear Factor kappa B ELISA Kit

Sign In for Pricing
View Details
Monkey Phospho-Nuclear Factor kappa B ELISA Kit
MBS743649-03 5x 96 Well

Monkey Phospho-Nuclear Factor kappa B ELISA Kit

Sign In for Pricing
View Details
Monkey Phospho-Nuclear Factor kappa B ELISA Kit
MBS743649-04 10x 96 Well

Monkey Phospho-Nuclear Factor kappa B ELISA Kit

Sign In for Pricing
View Details