Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD1 Rabbit Polyclonal Antibody (HRP)

BTBD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C15orf1, NS5ATP8

UniProt

Q9H0C5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BTBD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLGKGRGAAAAGGP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_079514

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CD22 (Y807) Polyclonal Antibody
BT-PHS00448-01 20 µL

Phospho-CD22 (Y807) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-CD22 (Y807) Polyclonal Antibody
BT-PHS00448-02 50 µL

Phospho-CD22 (Y807) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-CD22 (Y807) Polyclonal Antibody
BT-PHS00448-03 100 µL

Phospho-CD22 (Y807) Polyclonal Antibody

Sign In for Pricing
View Details
1X Phosphate Buffered Saline (PBS) for molecular biology
95131-01 100 mL

1X Phosphate Buffered Saline (PBS) for molecular biology

Sign In for Pricing
View Details
1X Phosphate Buffered Saline (PBS) for molecular biology
95131-02 500 mL

1X Phosphate Buffered Saline (PBS) for molecular biology

Sign In for Pricing
View Details
C15orf39 Protein Vector (Human) (pPM-N-D-C-His)
PV328993 500 ng

C15orf39 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details