Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCA2 Rabbit Polyclonal Antibody (FITC)

SMARCA2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BRM, SNF2, SWI2, hBRM, NCBRS, Sth1p, BAF190, SNF2L2, SNF2LA, hSNF2a

UniProt

P51531, P51532

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SMARCA2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKY

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Cyano-N- (4-phenoxyphenyl) acetamide
FDA41913-01 0.5 g

2-Cyano-N- (4-phenoxyphenyl) acetamide

Sign In for Pricing
View Details
2-Cyano-N- (4-phenoxyphenyl) acetamide
FDA41913-02 5 g

2-Cyano-N- (4-phenoxyphenyl) acetamide

Sign In for Pricing
View Details
Rpgrip1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4370808 1.0 µg DNA

Rpgrip1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Monkey Von Willebrand Factor cleaving protease ELISA Kit
MBS735814-01 48 Well

Monkey Von Willebrand Factor cleaving protease ELISA Kit

Sign In for Pricing
View Details
Monkey Von Willebrand Factor cleaving protease ELISA Kit
MBS735814-02 96 Well

Monkey Von Willebrand Factor cleaving protease ELISA Kit

Sign In for Pricing
View Details
Monkey Von Willebrand Factor cleaving protease ELISA Kit
MBS735814-03 5x 96 Well

Monkey Von Willebrand Factor cleaving protease ELISA Kit

Sign In for Pricing
View Details