Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF575 Rabbit Polyclonal Antibody (HRP)

ZNF575 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q86XF7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF575

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRRRPPPQRPHRCPDCDKAFSYPSKLATHRLAHGGARPHPCPDCPKAFSY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_777605.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1512 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4153408 1.0 µg DNA

Olfr1512 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ACVRL1 sgRNA CRISPR Lentivector (Human) (Target 2)
K0039903 1.0 µg DNA

ACVRL1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
XBP1, CT (XBP1, TREB5, XBP2, X-box-binding protein 1, Tax-responsive element-binding protein 5) (MaxLight 750)
MBS6363905-01 0.1 mL

XBP1, CT (XBP1, TREB5, XBP2, X-box-binding protein 1, Tax-responsive element-binding protein 5) (MaxLight 750)

Sign In for Pricing
View Details
XBP1, CT (XBP1, TREB5, XBP2, X-box-binding protein 1, Tax-responsive element-binding protein 5) (MaxLight 750)
MBS6363905-02 5x 0.1 mL

XBP1, CT (XBP1, TREB5, XBP2, X-box-binding protein 1, Tax-responsive element-binding protein 5) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Staphopain B (sspB)
orb1650886-01 20 µg

Recombinant Staphylococcus aureus Staphopain B (sspB)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Staphopain B (sspB)
orb1650886-02 100 µg

Recombinant Staphylococcus aureus Staphopain B (sspB)

Sign In for Pricing
View Details