Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF575 Rabbit Polyclonal Antibody (Biotin)

ZNF575 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q86XF7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF575

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PRRRPPPQRPHRCPDCDKAFSYPSKLATHRLAHGGARPHPCPDCPKAFSY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_777605.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thy-1 (human) :Fc (human), (recombinant)
ALX-522-091-C050 50 µg

Thy-1 (human) :Fc (human), (recombinant)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human KIR3DL2 (Killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX3905K Each

Magic™ Membrane Protein Human KIR3DL2 (Killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Sign In for Pricing
View Details
Mouse Monoclonal Integrin beta 1D Antibody (1G2) [DyLight 650]
NBP1-97733C 0.1 mL

Mouse Monoclonal Integrin beta 1D Antibody (1G2) [DyLight 650]

Sign In for Pricing
View Details
ANKRD29 Protein Vector (Mouse) (pPB-C-His)
PV154558 500 ng

ANKRD29 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Gpr113 siRNA Oligos set (Mouse)
22487174 3x 5 nmol

Gpr113 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
SNRPN Human shRNA Lentiviral Particle (Locus ID 6638)
TL318853V 500 µL Each

SNRPN Human shRNA Lentiviral Particle (Locus ID 6638)

Sign In for Pricing
View Details