Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX7 Rabbit Polyclonal Antibody (FITC)

CBX7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

O95931

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CBX7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_783640

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNIPL (NM_138278) Human Recombinant Protein
PROTQ7Z465 20 µg

BNIPL (NM_138278) Human Recombinant Protein

Sign In for Pricing
View Details
KD-Validated Anti-Growth differentiation factor 3 Rabbit Monoclonal Antibody
AGI1064-100 100 µL

KD-Validated Anti-Growth differentiation factor 3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NR2E3 Antibody
orb1316571 100 µL

NR2E3 Antibody

Sign In for Pricing
View Details
Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Peptide deformylase (def)
MBS1451646-01 0.02 mg (E-Coli)

Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Peptide deformylase (def)

Sign In for Pricing
View Details
Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Peptide deformylase (def)
MBS1451646-02 0.1 mg (E-Coli)

Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Peptide deformylase (def)

Sign In for Pricing
View Details
Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Peptide deformylase (def)
MBS1451646-03 0.02 mg (Yeast)

Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Peptide deformylase (def)

Sign In for Pricing
View Details