Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ONECUT3 Rabbit Polyclonal Antibody (FITC)

ONECUT3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OC3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LOC390874

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VTISQQLGLELNTVSNFFMNARRRCMNRWAEEPSTAPGGPAGATATFSKA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

XP_372702

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCR6, Bonzo, NT (STRL33, TYMSTR) (MaxLight 650)
MBS6471105-01 0.1 mL

CXCR6, Bonzo, NT (STRL33, TYMSTR) (MaxLight 650)

Sign In for Pricing
View Details
CXCR6, Bonzo, NT (STRL33, TYMSTR) (MaxLight 650)
MBS6471105-02 5x 0.1 mL

CXCR6, Bonzo, NT (STRL33, TYMSTR) (MaxLight 650)

Sign In for Pricing
View Details
TIM-1, Control Peptide (T Cell Immunoglobin Domain and Mucin Domain Protein 1, TIM 1, TIM1, TIMD 1, TIMD1, TIMD-1, Hepatitis A Virus Cellular Receptor 1, HAVCR 1, HAVCR1, HAVCR-1, Kidney Injury Molecule 1, KIM1, KIM-1)
147008 50 µg

TIM-1, Control Peptide (T Cell Immunoglobin Domain and Mucin Domain Protein 1, TIM 1, TIM1, TIMD 1, TIMD1, TIMD-1, Hepatitis A Virus Cellular Receptor 1, HAVCR 1, HAVCR1, HAVCR-1, Kidney Injury Molecule 1, KIM1, KIM-1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Matrix Metalloproteinase 2 (MMP2)
MBS2144971-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Matrix Metalloproteinase 2 (MMP2)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Matrix Metalloproteinase 2 (MMP2)
MBS2144971-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Matrix Metalloproteinase 2 (MMP2)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Matrix Metalloproteinase 2 (MMP2)
MBS2144971-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Matrix Metalloproteinase 2 (MMP2)

Sign In for Pricing
View Details