Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLX4 Rabbit Polyclonal Antibody (FITC)

DLX4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BP1, DLX7, DLX8, DLX9, OFC15

UniProt

Q92988

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DLX4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001925

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDX2 (GI Epithelial Marker) (CDX2/2951R), CF740 conjugate, 0.1mg/mL
BNC742951-500 1x 500 µL

CDX2 (GI Epithelial Marker) (CDX2/2951R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Apc6 (CDC16) Rabbit Polyclonal Antibody
AP20213PU-N 100 µg

Apc6 (CDC16) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CYP7A1 (C-term) Rabbit Polyclonal Antibody
AP14901PU-N 400 µL

CYP7A1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SQSTM1 (NM_003900) Human Over-expression Lysate
LY401285 100 µg

SQSTM1 (NM_003900) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PGRMC2 activation kit by CRISPRa
GA107107 1 Kit

Human PGRMC2 activation kit by CRISPRa

Sign In for Pricing
View Details
PD-L1 (CD274) Mouse Monoclonal Antibody [Clone ID: OTI7D4]
CF812996 100 µg

PD-L1 (CD274) Mouse Monoclonal Antibody [Clone ID: OTI7D4]

Sign In for Pricing
View Details