Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZMYM3 Rabbit Polyclonal Antibody (FITC)

ZMYM3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MYM, XFIM, ZNF261, DXS6673E, ZNF198L2

UniProt

Q14202

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZMYM3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

152kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005087

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CBX2, His-tagged
CBX2-10767H 25 µg

Recombinant Human CBX2, His-tagged

Sign In for Pricing
View Details
Human high sensitivity C-Reactive Protein, hs-CRP ELISA Kit
YLA1856HU-01 48 Tests

Human high sensitivity C-Reactive Protein, hs-CRP ELISA Kit

Sign In for Pricing
View Details
Human high sensitivity C-Reactive Protein, hs-CRP ELISA Kit
YLA1856HU-02 96 Tests

Human high sensitivity C-Reactive Protein, hs-CRP ELISA Kit

Sign In for Pricing
View Details
Lentiviral human RASL11B shRNA (UAS) - Lentiviral human RASL11B shRNA (UAS, iRFP) plasmid
GTR15152836 1 Vial

Lentiviral human RASL11B shRNA (UAS) - Lentiviral human RASL11B shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
HEBP1 (Heme Binding Protein 1, HBP, HEBP) (FITC)
246989-FITC 100 µL

HEBP1 (Heme Binding Protein 1, HBP, HEBP) (FITC)

Sign In for Pricing
View Details
WFDC9 3'UTR GFP Stable Cell Line
TU078475 1.0 mL

WFDC9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details