Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZMYM3 Rabbit Polyclonal Antibody (HRP)

ZMYM3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MYM, XFIM, ZNF261, DXS6673E, ZNF198L2

UniProt

Q14202

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZMYM3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

152kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005087

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp809 Mouse Gene Knockout Kit (CRISPR)
KN519992 1 Kit

Zfp809 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Anti-Human HLA-A, B, C Antibody[W6/32]
E-AB-F1130C-01 20 Tests

FITC Anti-Human HLA-A, B, C Antibody[W6/32]

Sign In for Pricing
View Details
FITC Anti-Human HLA-A, B, C Antibody[W6/32]
E-AB-F1130C-02 100 Tests

FITC Anti-Human HLA-A, B, C Antibody[W6/32]

Sign In for Pricing
View Details
FITC Anti-Human HLA-A, B, C Antibody[W6/32]
E-AB-F1130C-03 2x 100 Tests

FITC Anti-Human HLA-A, B, C Antibody[W6/32]

Sign In for Pricing
View Details
MHC Class II Recombinant Rabbit monoclonal Antibody
HA750404 100 µL

MHC Class II Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
cis-3-Aminocyclobutanol Hydrochloride
TRC-C017291-2.5G 2.5 g

cis-3-Aminocyclobutanol Hydrochloride

Sign In for Pricing
View Details