Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZMYM3 Rabbit Polyclonal Antibody (Biotin)

ZMYM3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MYM, XFIM, ZNF261, DXS6673E, ZNF198L2

UniProt

Q14202

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZMYM3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

152kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005087

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Sestrin-2 ELISA Kit
EK3326 Inquire

Human Sestrin-2 ELISA Kit

Sign In for Pricing
View Details
DLG2 Antibody, HRP conjugated
A55519-100UG 100 µg

DLG2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Human PADI4 Protein, N-GST & C-His
YHJ81002 100 μg

Recombinant Human PADI4 Protein, N-GST & C-His

Sign In for Pricing
View Details
Bovine Thyroid antibody ELISA kit
GTR10408339 96 Well

Bovine Thyroid antibody ELISA kit

Sign In for Pricing
View Details
KBTBD13 Rabbit Polyclonal Antibody (BF680)
orb2493490 100 µL

KBTBD13 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
OTOP3, CT (OTOP3, Otopetrin-3) (Azide free) (HRP) discontinued
039530-HRP 200 µL

OTOP3, CT (OTOP3, Otopetrin-3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details