Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZMYM3 Rabbit Polyclonal Antibody (Biotin)

ZMYM3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MYM, XFIM, ZNF261, DXS6673E, ZNF198L2

UniProt

Q14202

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZMYM3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

152kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005087

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6C4 (NM_001005494) Human Untagged Clone
SC300977 10 µg

OR6C4 (NM_001005494) Human Untagged Clone

Sign In for Pricing
View Details
Plcl2 3'UTR Lenti-reporter-Luc Vector
36955086 1.0 µg

Plcl2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
DSC3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
18608156 3x 1.0 µg DNA

DSC3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YMR173W-A Polyclonal Antibody
MBS7147135 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YMR173W-A Polyclonal Antibody

Sign In for Pricing
View Details
4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)
OR1028426-01 5 g

4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)

Sign In for Pricing
View Details
4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)
OR1028426-02 25 g

4,4'- (Ethane-1,1-diyl) bis (cyanatobenzene)

Sign In for Pricing
View Details