Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arc Rabbit Polyclonal Antibody (FITC)

Arc Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Arc3, mArc, Arc3.1, C86064, arg3.1

UniProt

Q7LC44

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TIANLERWVKREMHVWREVFYRLERWADRLESMGGKYPVGSEPARHTVSV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001099748

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mesocricetus auratus Mucin-1 (MUC1), partial
MBS1297244 Inquire

Recombinant Mesocricetus auratus Mucin-1 (MUC1), partial

Sign In for Pricing
View Details
Canine Keratin, Type I Cytoskeletal 16 (KRT16) ELISA Kit
MBS9390290-01 48 Well

Canine Keratin, Type I Cytoskeletal 16 (KRT16) ELISA Kit

Sign In for Pricing
View Details
Canine Keratin, Type I Cytoskeletal 16 (KRT16) ELISA Kit
MBS9390290-02 96 Well

Canine Keratin, Type I Cytoskeletal 16 (KRT16) ELISA Kit

Sign In for Pricing
View Details
Canine Keratin, Type I Cytoskeletal 16 (KRT16) ELISA Kit
MBS9390290-03 5x 96 Well

Canine Keratin, Type I Cytoskeletal 16 (KRT16) ELISA Kit

Sign In for Pricing
View Details
Canine Keratin, Type I Cytoskeletal 16 (KRT16) ELISA Kit
MBS9390290-04 10x 96 Well

Canine Keratin, Type I Cytoskeletal 16 (KRT16) ELISA Kit

Sign In for Pricing
View Details
Rat Lhfpl1 Pre-designed siRNA Set B
SI207594B 1 Each

Rat Lhfpl1 Pre-designed siRNA Set B

Sign In for Pricing
View Details