Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ergic2 Rabbit Polyclonal Antibody (HRP)

Ergic2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ptx1, AA408438, 1200009B18Rik, 4930572C01Rik

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ergic2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MRRLNRRKTLSLVKELDAFPKVPDSYVETSASGGTVSLIAFTTMALLTIM

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_080631

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin heavy chain 2 Recombinant Antibody, Cy3 Conjugated
bsm-62856R-Cy3 100 µL

Myosin heavy chain 2 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Rat Ankrd12 Pre-designed siRNA Set A
SI200630A 1 Each

Rat Ankrd12 Pre-designed siRNA Set A

Sign In for Pricing
View Details
COL8A2 (Collagen, Type VIII, alpha 2, FECD, FLJ00201, MGC116970, MGC116972, PPCD, PPCD2) (APC)
244842-APC 100 µL

COL8A2 (Collagen, Type VIII, alpha 2, FECD, FLJ00201, MGC116970, MGC116972, PPCD, PPCD2) (APC)

Sign In for Pricing
View Details
2- (4- (Methylsulfonyl) piperazin-1-yl) ethanamine
OR1072357-01 100 mg

2- (4- (Methylsulfonyl) piperazin-1-yl) ethanamine

Sign In for Pricing
View Details
2- (4- (Methylsulfonyl) piperazin-1-yl) ethanamine
OR1072357-02 250 mg

2- (4- (Methylsulfonyl) piperazin-1-yl) ethanamine

Sign In for Pricing
View Details
2- (4- (Methylsulfonyl) piperazin-1-yl) ethanamine
OR1072357-03 1 g

2- (4- (Methylsulfonyl) piperazin-1-yl) ethanamine

Sign In for Pricing
View Details