Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LARP2 Rabbit Polyclonal Antibody (HRP)

LARP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LARP, Lar1, Lhp1

UniProt

Q6PKG0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LARP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

116kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_056130

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Nitrobenzoic Acid
TRC-N493550-1KG 1 Kg

4-Nitrobenzoic Acid

Sign In for Pricing
View Details
VC 1kb-Ex DNA Ladder, 50µg
NL1413 50 µg

VC 1kb-Ex DNA Ladder, 50µg

Sign In for Pricing
View Details
Recombinant Mouse IL-28A protein (His Tag)
PKSM041473-01 20 µg

Recombinant Mouse IL-28A protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-28A protein (His Tag)
PKSM041473-02 100 µg

Recombinant Mouse IL-28A protein (His Tag)

Sign In for Pricing
View Details
Phytic Acid (Technical Grade)
TRC-P398700-250MG 250 mg

Phytic Acid (Technical Grade)

Sign In for Pricing
View Details
NOTCH1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C9]
TA500248AM 100 µL

NOTCH1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C9]

Sign In for Pricing
View Details