Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM58 Rabbit Polyclonal Antibody (FITC)

TRIM58 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BIA2

UniProt

Q8NG06

Immunogen

The immunogen for Anti-TRIM58 antibody is: synthetic peptide directed towards the N-terminal region of Human TRI58

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HRTHRTAPLQEAAGSYQVKLQMALELMRKELEDALTQEANVGKKTVIWKE

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASH1L-IT1 Protein Vector (Human) (pPM-C-His)
PV063428 500 ng

ASH1L-IT1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Bim Rabbit mAb
E45R12745N 50 ul

Bim Rabbit mAb

Sign In for Pricing
View Details
ARGLU1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV652615 1.0 µg DNA

ARGLU1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Glycyl tRNA Synthetase, GARS ELISA KIT
E2239Hu-01 48 Well

Human Glycyl tRNA Synthetase, GARS ELISA KIT

Sign In for Pricing
View Details
Human Glycyl tRNA Synthetase, GARS ELISA KIT
E2239Hu-02 96 Well

Human Glycyl tRNA Synthetase, GARS ELISA KIT

Sign In for Pricing
View Details
Human Glycyl tRNA Synthetase, GARS ELISA KIT
E2239Hu-03 5x 96 Tests

Human Glycyl tRNA Synthetase, GARS ELISA KIT

Sign In for Pricing
View Details