Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM58 Rabbit Polyclonal Antibody (HRP)

TRIM58 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BIA2

UniProt

Q8NG06

Immunogen

The immunogen for Anti-TRIM58 antibody is: synthetic peptide directed towards the N-terminal region of Human TRI58

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HRTHRTAPLQEAAGSYQVKLQMALELMRKELEDALTQEANVGKKTVIWKE

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ugt2b38 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3109806 1.0 µg DNA

Ugt2b38 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
NCAM1 Antibody
orb2312129-01 20 µg

NCAM1 Antibody

Sign In for Pricing
View Details
NCAM1 Antibody
orb2312129-02 100 µg

NCAM1 Antibody

Sign In for Pricing
View Details
NCAM1 Antibody
orb2312129-03 100 ug (without BSA and Azide)

NCAM1 Antibody

Sign In for Pricing
View Details
FAM83F (h) -PR
sc-77312-PR 10 µM - 20 µL

FAM83F (h) -PR

Sign In for Pricing
View Details
Sytl5 sgRNA CRISPR Lentivector set (Mouse)
K3576801 3x 1.0 µg

Sytl5 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details