Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM58 Rabbit Polyclonal Antibody (HRP)

TRIM58 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BIA2

UniProt

Q8NG06

Immunogen

The immunogen for Anti-TRIM58 antibody is: synthetic peptide directed towards the N-terminal region of Human TRI58

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HRTHRTAPLQEAAGSYQVKLQMALELMRKELEDALTQEANVGKKTVIWKE

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-human IL-9 mAb (F42)
A09D59-F42 1 Each

Human anti-human IL-9 mAb (F42)

Sign In for Pricing
View Details
Human anti-hCG antibody (hCGAb) IgG
E4A11C49-G 50 µg

Human anti-hCG antibody (hCGAb) IgG

Sign In for Pricing
View Details
Porcine Chaperone activity of bc1 complex like, mitochondrial (CABC1) ELISA Kit
GTR10355747 96 Well

Porcine Chaperone activity of bc1 complex like, mitochondrial (CABC1) ELISA Kit

Sign In for Pricing
View Details
OAAB18183-400UL - ATP5I Antibody - C-terminal region
OAAB18183-400UL 400 µL

OAAB18183-400UL - ATP5I Antibody - C-terminal region

Sign In for Pricing
View Details
OTOP1 Antibody (HRP)
orb516747-01 50 µg

OTOP1 Antibody (HRP)

Sign In for Pricing
View Details
OTOP1 Antibody (HRP)
orb516747-02 100 µg

OTOP1 Antibody (HRP)

Sign In for Pricing
View Details