Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFB1M Rabbit Polyclonal Antibody (FITC)

TFB1M Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CGI75, mtTFB, CGI-75, mtTFB1

UniProt

Q8WVM0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TFB1M

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IIKWLENISCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRSRLSVMA

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057104

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL28RA Protein, His (Fc)-Avi-tagged
IL28RA-3151H 50 µg

Recombinant Human IL28RA Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Clostridium sordellii One-Step PCR kit
Oneq-V215-100D 100T

Clostridium sordellii One-Step PCR kit

Sign In for Pricing
View Details
Human QTRT1 qPCR Primer Pair
QH54325S 200 Tests

Human QTRT1 qPCR Primer Pair

Sign In for Pricing
View Details
Human Orexin receptor type 2 (OX2R/HCRTR2) ELISA Kit
YLA4564HU-01 48 Tests

Human Orexin receptor type 2 (OX2R/HCRTR2) ELISA Kit

Sign In for Pricing
View Details
Human Orexin receptor type 2 (OX2R/HCRTR2) ELISA Kit
YLA4564HU-02 96 Tests

Human Orexin receptor type 2 (OX2R/HCRTR2) ELISA Kit

Sign In for Pricing
View Details
NADPH Oxidase 4 Rabbit Polyclonal Antibody, 1 pack = 50 µL
BAL4425 1 Each

NADPH Oxidase 4 Rabbit Polyclonal Antibody, 1 pack = 50 µL

Sign In for Pricing
View Details