Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFB1M Rabbit Polyclonal Antibody (HRP)

TFB1M Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CGI75, mtTFB, CGI-75, mtTFB1

UniProt

Q8WVM0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TFB1M

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IIKWLENISCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRSRLSVMA

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057104

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1560394 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
39219066 1.0 µg DNA

RGD1560394 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Acamprosate Calcium
C09579-5mg 5 mg

Acamprosate Calcium

Sign In for Pricing
View Details
RHEBL1 Protein Vector (Mouse) (pPM-C-HA)
PV223996 500 ng

RHEBL1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
GATA-4 (phospho Ser262) Polyclonal Antibody
RA25242-01 50 µL

GATA-4 (phospho Ser262) Polyclonal Antibody

Sign In for Pricing
View Details
GATA-4 (phospho Ser262) Polyclonal Antibody
RA25242-02 100 µL

GATA-4 (phospho Ser262) Polyclonal Antibody

Sign In for Pricing
View Details
Porcine Immunoglobulin A antibody ELISA Kit
GTR10369059 96 Well

Porcine Immunoglobulin A antibody ELISA Kit

Sign In for Pricing
View Details