Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFB1M Rabbit Polyclonal Antibody (Biotin)

TFB1M Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CGI75, mtTFB, CGI-75, mtTFB1

UniProt

Q8WVM0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TFB1M

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IIKWLENISCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRSRLSVMA

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057104

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Alpha-S1-casein (CSN1S1)
MBS958088-01 0.02 mg (Yeast)

Recombinant Bovine Alpha-S1-casein (CSN1S1)

Sign In for Pricing
View Details
Recombinant Bovine Alpha-S1-casein (CSN1S1)
MBS958088-02 0.1 mg (Yeast)

Recombinant Bovine Alpha-S1-casein (CSN1S1)

Sign In for Pricing
View Details
Recombinant Bovine Alpha-S1-casein (CSN1S1)
MBS958088-03 1 mg (Yeast)

Recombinant Bovine Alpha-S1-casein (CSN1S1)

Sign In for Pricing
View Details
Recombinant Bovine Alpha-S1-casein (CSN1S1)
MBS958088-04 5x 1 mg (Yeast)

Recombinant Bovine Alpha-S1-casein (CSN1S1)

Sign In for Pricing
View Details
SDAD1/NUC130 Rabbit Polyclonal Antibody (PE-Cy5)
orb954667 100 µL

SDAD1/NUC130 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Camel Non-Syndromic Hearing Impairment Protein 5 (DFNA5) ELISA Kit
MBS9923251-01 48 Well

Camel Non-Syndromic Hearing Impairment Protein 5 (DFNA5) ELISA Kit

Sign In for Pricing
View Details