Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTRAF Rabbit Polyclonal Antibody (HRP)

RTRAF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CLE, CLE7, hCLE, CGI99, RLLM1, hCLE1, CGI-99, LCRP369, C14orf166

UniProt

Q9Y224

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C14orf166

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057123

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Salmonella typhi Outer membrane protein A polyclonal Antibody
MBS1488520-01 0.05 mg

Rabbit anti-Salmonella typhi Outer membrane protein A polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Salmonella typhi Outer membrane protein A polyclonal Antibody
MBS1488520-02 0.1 mg

Rabbit anti-Salmonella typhi Outer membrane protein A polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Salmonella typhi Outer membrane protein A polyclonal Antibody
MBS1488520-03 5x 0.1 mg

Rabbit anti-Salmonella typhi Outer membrane protein A polyclonal Antibody

Sign In for Pricing
View Details
Human Tumor protein D52, TPD52 ELISA Kit
MBS9337551-01 48 Well

Human Tumor protein D52, TPD52 ELISA Kit

Sign In for Pricing
View Details
Human Tumor protein D52, TPD52 ELISA Kit
MBS9337551-02 96 Well

Human Tumor protein D52, TPD52 ELISA Kit

Sign In for Pricing
View Details
Human Tumor protein D52, TPD52 ELISA Kit
MBS9337551-03 5x 96 Well

Human Tumor protein D52, TPD52 ELISA Kit

Sign In for Pricing
View Details