Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF141 Rabbit Polyclonal Antibody (FITC)

RNF141 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZFP26, RFP141, ZNF230

UniProt

Q8WVD5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RNF141

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGR

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057506

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYPN CRISPR Knock Out 293T Cell Line (Human)
31335141 1x 10^6 Cells / 1.0 mL

MYPN CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Recombinant Human MRCL3 Protein
NBP1-72407-100ug 100 µg

Recombinant Human MRCL3 Protein

Sign In for Pricing
View Details
C3ORF31 Polyclonal Antibody, Cy3 Conjugated
bs-15173R-Cy3 100 µL

C3ORF31 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Monoclonal Prolactin Receptor (hPRL-Receptor) Antibody - Without BSA, Clone: B6.2 + PRLR742
APR07458G 0.1mg

Monoclonal Prolactin Receptor (hPRL-Receptor) Antibody - Without BSA, Clone: B6.2 + PRLR742

Sign In for Pricing
View Details
Hint2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3557504 1.0 µg DNA

Hint2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
UNQ9391 Double Nickase Plasmid (h2)
sc-415032-NIC-2 20 µg

UNQ9391 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details