Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PER3 Rabbit Polyclonal Antibody (HRP)

PER3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GIG13, FASPS3

UniProt

P56645

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PER3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DATLFCEPWTLNMQPAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFRE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

133kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rat, Sheep, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Aconitate hydratase B Antibody (4C2B3) [Alexa Fluor 532]
NBP3-06090AF532 0.1 mL

Mouse Monoclonal Aconitate hydratase B Antibody (4C2B3) [Alexa Fluor 532]

Sign In for Pricing
View Details
Syntaxin binding protein 4 (STXBP4) (NM_178509) Human Recombinant Protein
E45H35910M5 20 µg

Syntaxin binding protein 4 (STXBP4) (NM_178509) Human Recombinant Protein

Sign In for Pricing
View Details
Gnat1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3926508 1.0 µg DNA

Gnat1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
FOXO1a (FKH1, FKHR, FOXO1, Forkhead Box O1a, Forkhead Homolog1, Forkhead Rhabdomysarcoma) (AP)
MBS6241939-01 0.1 mL

FOXO1a (FKH1, FKHR, FOXO1, Forkhead Box O1a, Forkhead Homolog1, Forkhead Rhabdomysarcoma) (AP)

Sign In for Pricing
View Details
FOXO1a (FKH1, FKHR, FOXO1, Forkhead Box O1a, Forkhead Homolog1, Forkhead Rhabdomysarcoma) (AP)
MBS6241939-02 5x 0.1 mL

FOXO1a (FKH1, FKHR, FOXO1, Forkhead Box O1a, Forkhead Homolog1, Forkhead Rhabdomysarcoma) (AP)

Sign In for Pricing
View Details
BRAF Antibody
GWB-11F916 0.1 mL

BRAF Antibody

Sign In for Pricing
View Details