Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PER3 Rabbit Polyclonal Antibody (Biotin)

PER3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GIG13, FASPS3

UniProt

P56645

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PER3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DATLFCEPWTLNMQPAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFRE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

133kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rat, Sheep, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFC2, NT (Replication Factor C Subunit 2, Activator 1 Subunit 2, Replication Factor C 40kD Subunit, RF-C 40kD Subunit, RFC40, Activator 1 40kD Subunit, A1 40kD Subunit) (MaxLight 750)
MBS6497441-01 0.1 mL

RFC2, NT (Replication Factor C Subunit 2, Activator 1 Subunit 2, Replication Factor C 40kD Subunit, RF-C 40kD Subunit, RFC40, Activator 1 40kD Subunit, A1 40kD Subunit) (MaxLight 750)

Sign In for Pricing
View Details
RFC2, NT (Replication Factor C Subunit 2, Activator 1 Subunit 2, Replication Factor C 40kD Subunit, RF-C 40kD Subunit, RFC40, Activator 1 40kD Subunit, A1 40kD Subunit) (MaxLight 750)
MBS6497441-02 5x 0.1 mL

RFC2, NT (Replication Factor C Subunit 2, Activator 1 Subunit 2, Replication Factor C 40kD Subunit, RF-C 40kD Subunit, RFC40, Activator 1 40kD Subunit, A1 40kD Subunit) (MaxLight 750)

Sign In for Pricing
View Details
HNRNPU Antibody
orb1257795 100 µL

HNRNPU Antibody

Sign In for Pricing
View Details
FluorLast™ Mounting Media
1213-20 20 mL

FluorLast™ Mounting Media

Sign In for Pricing
View Details
FTHL17/CT38 Polyclonal Antibody
orb1419462 100 µL

FTHL17/CT38 Polyclonal Antibody

Sign In for Pricing
View Details
CE112 rabbit pAb
RA31538-01 50 µL

CE112 rabbit pAb

Sign In for Pricing
View Details